Skip to main page content
U.S. flag

An official website of the United States government

Dot gov

The .gov means it’s official.
Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you’re on a federal government site.

Https

The site is secure.
The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.

Access keys NCBI Homepage MyNCBI Homepage Main Content Main Navigation

Search Page

Filters

My NCBI Filters

Results by year

Table representation of search results timeline featuring number of search results per year.

Year Number of Results
1984 1
1985 1
1986 1
1987 2
1990 2
1991 4
1992 3
1993 3
1994 4
1995 2
1996 2
1997 1
1998 3
1999 2
2000 5
2001 4
2002 3
2003 1
2004 2
2005 4
2006 1
2007 3
2008 4
2009 2
2010 6
2011 5
2012 10
2013 1
2014 4
2015 2
2016 1
2017 2
2018 1
2019 1
2020 2
2021 2
2022 1
2023 1
2024 1

Text availability

Article attribute

Article type

Publication date

Search Results

94 results

Results by year

Filters applied: . Clear all
Your search was processed without automatic term mapping because it retrieved zero results.
Page 1
Showing results for lys c. Thomas
Your search for Alys C. Thomas retrieved no results
HSDAVFTDNYTKLRKQ-NIe-AVKK-(3-OCH3,4-OH)-FLNSSV-GABA-L-(Dap-(BMA)2)-64Cu.
Cheng KT, Thakur ML. Cheng KT, et al. 2008 Mar 17 [updated 2008 Jun 11]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. 2008 Mar 17 [updated 2008 Jun 11]. In: Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004–2013. PMID: 20641421 Free Books & Documents. Review.
VIP (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH(2)) is a hydrophobic, basic peptide that contains three lysine residues (, and , ), two arginine residues ( and , ), two tyrosine residues ( and , ), an essential histidine residue at the N terminus, and an amidated C-terminus (10). The …
VIP (HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH(2)) is a hydrophobic, basic peptide that contains three lysine residues (, and , ), two arginine residu …
ISGylation: a conserved pathway in mammalian pregnancy.
Hansen TR, Pru JK. Hansen TR, et al. Adv Exp Med Biol. 2014;759:13-31. doi: 10.1007/978-1-4939-0817-2_2. Adv Exp Med Biol. 2014. PMID: 25030758 Review.
One of these genes is called interferon stimulated gene 15 (ISG15), which encodes a ubiquitin homolog with a C-terminal Gly that becomes covalently attached to Lys residues on targeted proteins through an ATP-dependent multi-step enzymatic reaction called ISGylation …
One of these genes is called interferon stimulated gene 15 (ISG15), which encodes a ubiquitin homolog with a C-terminal Gly that beco …
Feeding rumen-protected lysine prepartum increases energy-corrected milk and milk component yields in Holstein cows during early lactation.
Fehlberg LK, Guadagnin AR, Thomas BL, Sugimoto Y, Shinzato I, Cardoso FC. Fehlberg LK, et al. J Dairy Sci. 2020 Dec;103(12):11386-11400. doi: 10.3168/jds.2020-18542. Epub 2020 Oct 9. J Dairy Sci. 2020. PMID: 33041036 Free article.
Body weight (717 6 kg) was greater and DMI (18.1 0.7 kg) tended to be greater for cows in PRE-L POST-L and PRE-L POST-C compared with those that were in PRE-C POST-L and PRE-C POST-C (707 6 and 16.8 0.7 kg, respectively). ...Plasma concentrations of …
Body weight (717 6 kg) was greater and DMI (18.1 0.7 kg) tended to be greater for cows in PRE-L POST-L and PRE-L POST-C compared with …
Dipeptide inhibitors of the prostate specific membrane antigen (PSMA): A comparison of urea and thiourea derivatives.
Young JD, Ma MT, Eykyn TR, Atkinson RA, Abbate V, Cilibrizzi A, Hider RC, Blower PJ. Young JD, et al. Bioorg Med Chem Lett. 2021 Jun 15;42:128044. doi: 10.1016/j.bmcl.2021.128044. Epub 2021 Apr 16. Bioorg Med Chem Lett. 2021. PMID: 33865971 Free article.
Inhibitors of this receptor are used to target molecular imaging agents and molecular radiotherapy agents to prostate cancer and if the affinity of inhibitors for GCP(II)/PSMA could be improved, targeting might also improve. Compounds containing the dipeptide OH-Lys-C …
Inhibitors of this receptor are used to target molecular imaging agents and molecular radiotherapy agents to prostate cancer and if the affi …
NMR Insights into the Structure-Function Relationships in the Binding of Melanocortin Analogues to the MC1R Receptor.
Morais M, Zamora-Carreras H, Raposinho PD, Oliveira MC, Pantoja-Uceda D, Correia JDG, Jiménez MA. Morais M, et al. Molecules. 2017 Jul 15;22(7):1189. doi: 10.3390/molecules22071189. Molecules. 2017. PMID: 28714883 Free PMC article.
To that end, we synthesised two macrocyclic isomeric alpha-MSH analogues, c[NH-NO2-C6H3-CO-His-DPhe-Arg-Trp-Lys]-Lys-NH2 (CycN-K6) and c[NH-NO2-C6H3-CO-His-DPhe-Arg-Trp-Lys-Lys]-NH2 (CycN-K7). Their affinities to MC1R receptor were determ …
To that end, we synthesised two macrocyclic isomeric alpha-MSH analogues, c[NH-NO2-C6H3-CO-His-DPhe-Arg-Trp-Lys]-Lys-NH …
In-Membrane Nanostructuring of Cationic Amphiphiles Affects Their Antimicrobial Efficacy and Cytotoxicity: A Comparison Study between a De Novo Antimicrobial Lipopeptide and Traditional Biocides.
Fa K, Liu H, Gong H, Zhang L, Liao M, Hu X, Ciumac D, Li P, Webster J, Petkov J, Thomas RK, Lu JR. Fa K, et al. Langmuir. 2022 May 31;38(21):6623-6637. doi: 10.1021/acs.langmuir.2c00506. Epub 2022 May 19. Langmuir. 2022. PMID: 35587380 Free PMC article.
In this study, antimicrobial and cytotoxic properties of a de novo designed lipopeptide, CH(3)(CH(2))(12)CO-Lys-Lys-Gly-Gly-Ile-Ile-NH(2) (C(14)KKGGII), were assessed against that of two traditional cationic biocides C(n)TAB (n = 12 and 14), with diffe …
In this study, antimicrobial and cytotoxic properties of a de novo designed lipopeptide, CH(3)(CH(2))(12)CO-Lys-Lys-Gly-Gly-Il …
Characterization of a binding site for anionic phospholipids on KCNQ1.
Thomas AM, Harmer SC, Khambra T, Tinker A. Thomas AM, et al. J Biol Chem. 2011 Jan 21;286(3):2088-100. doi: 10.1074/jbc.M110.153551. Epub 2010 Nov 17. J Biol Chem. 2011. PMID: 21084310 Free PMC article.
Characteristically these channels are regulated via G(q/11)-coupled receptors and the inhibition seen after phospholipase C activation is now thought to occur from membrane phosphatidylinositol (4,5)-bisphosphate (PIP(2)) depletion. ...Using biochemical techniques we ident …
Characteristically these channels are regulated via G(q/11)-coupled receptors and the inhibition seen after phospholipase C activatio …
Arrestin2/clathrin interaction is regulated by key N- and C-terminal regions in arrestin2.
Kern RC, Kang DS, Benovic JL. Kern RC, et al. Biochemistry. 2009 Aug 4;48(30):7190-200. doi: 10.1021/bi900369c. Biochemistry. 2009. PMID: 19555118 Free PMC article.
Mutagenesis also identified Lys-4, Arg-7, Lys-10, and Lys-11 within the N-terminus as playing a key role in regulating clathrin binding. Based on similarities with visual arrestin, Lys-10 and Lys-11 likely function as phospho sensors in arrestin …
Mutagenesis also identified Lys-4, Arg-7, Lys-10, and Lys-11 within the N-terminus as playing a key role in regulating …
Characterization of the key step for light-driven hydrogen evolution in green algae.
Winkler M, Kuhlgert S, Hippler M, Happe T. Winkler M, et al. J Biol Chem. 2009 Dec 25;284(52):36620-36627. doi: 10.1074/jbc.M109.053496. Epub 2009 Oct 21. J Biol Chem. 2009. PMID: 19846550 Free PMC article.
These experiments in combination with in silico docking analyses indicate that electrostatic interactions between the conserved HydA1 residue Lys(396) and the C terminus of PetF as well as between the PetF residue Glu(122) and the N-terminal amino group of HydA1 pla …
These experiments in combination with in silico docking analyses indicate that electrostatic interactions between the conserved HydA1 residu …
A critical role in structure-specific DNA binding for the acetylatable lysine residues in HMGB1.
Assenberg R, Webb M, Connolly E, Stott K, Watson M, Hobbs J, Thomas JO. Assenberg R, et al. Biochem J. 2008 May 1;411(3):553-61. doi: 10.1042/BJ20071613. Biochem J. 2008. PMID: 18241198
The structure-specific DNA-binding protein HMGB1 (high-mobility group protein B1) which comprises two tandem HMG boxes (A and B) and an acidic C-terminal tail, is acetylated in vivo at Lys(2) and Lys(11) in the A box. ...We conclude that Lys(2) and …
The structure-specific DNA-binding protein HMGB1 (high-mobility group protein B1) which comprises two tandem HMG boxes (A and B) and an acid …
94 results